PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016479550.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB_related
Protein Properties Length: 250aa    MW: 29032.4 Da    PI: 5.2149
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016479550.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.71.2e-125297148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+++ eE e+ v+  ++lG++ W++Ia++++ gR ++++k++++++l
   XP_016479550.1 52 RGPFSMEEVEIVVKTYQELGNR-WSAIAARLP-GRIDNEVKNFFHTHL 97
                     89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500904.5881746IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.603.2E-103057IPR009057Homeodomain-like
SuperFamilySSF466897.37E-2130103IPR009057Homeodomain-like
PROSITE profilePS5129419.72647101IPR017930Myb domain
SMARTSM007172.4E-105199IPR001005SANT/Myb domain
PfamPF002495.8E-115297IPR001005SANT/Myb domain
CDDcd001672.36E-65497No hitNo description
Gene3DG3DSA:1.10.10.604.7E-1858101IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MVSRGRPKIE ILYHEIWHLE LEPHAQICRI AGRTGKSCRL RWVNYLSPDV KRGPFSMEEV  60
EIVVKTYQEL GNRWSAIAAR LPGRIDNEVK NFFHTHLKKH LGVLKSTTRA RSNKRELKKT  120
KGNERKNADK RSPDPVSSSD SSSIITCEEN QMMDVTMSLY QTDGDCYNVV DQPNIEMEIS  180
PVILESNPDD GGTYNSNCQQ LHDQFEYSHE YISEYYSSFD SIDQFDMSSF WFDELWDAET  240
SDFLRDVITN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-173010137108B-MYB
1h8a_C6e-173010157128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016479550.10.0PREDICTED: transcription factor WER-like
TrEMBLM1AF712e-60M1AF71_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000214987e-60(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.13e-31myb domain protein 15